Secretagogues≥99% (HPLC)
CJC-1295 / Ipamorelin Blend
$59.00
In Stock
A research blend of CJC-1295 (a GHRH analog without Drug Affinity Complex/DAC) and Ipamorelin (a selective GH secretagogue). Lyophilized powder for laboratory investigation of growth hormone secretion pathways. Lab tested for Purity > 99%, endotoxins < 0.05EU/mL
1
Chemical Specifications
- Purity (HPLC)
- ≥99% (HPLC)
- Molecular Weight
- CJC-1295: 3367.97 Da / Ipamorelin: 711.85 Da
- Category
- Secretagogues
- Form
- Lyophilized Powder
- Storage
- -20°C, desiccated
- Amino Acid Sequence
- CJC-1295: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL / Ipamorelin: Aib-HDFDK-NH2
Stored at −20°C
Third-Party Tested
Certificates of Analysis
Not for Human Consumption | Research Use Only. All products are intended strictly for in-vitro laboratory research purposes only. Not for human or animal consumption.
This product is intended solely for laboratory research. Not for human consumption. No therapeutic claims are made or implied.
