Research Peptides≥98% (HPLC)
CJC-1295 / Ipamorelin Blend
$84.99
In Stock
A research blend of CJC-1295 (a GHRH analog with Drug Affinity Complex) and Ipamorelin (a selective GH secretagogue). Lyophilized powder for laboratory investigation of growth hormone secretion pathways.
1
Product Details
- Molecular Weight
- CJC-1295: 3367.97 Da / Ipamorelin: 711.85 Da
- Sequence
- CJC-1295: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL / Ipamorelin: Aib-HDFDK-NH2
Made in USA
Third-Party Tested
Certificates of Analysis
COA documentation pending — please check back soon.
For Research Purposes Only. Not for human consumption. Products are intended solely for in-vitro research and laboratory use.
This product is intended solely for laboratory research. Not for human consumption. No therapeutic claims are made or implied.