Secretagogues≥99% (HPLC)
Tesamorelin
$64.00
In Stock
Tesamorelin is a synthetic analog of growth hormone–releasing hormone (GHRH) studied for its interaction with peptide receptors and associated signaling pathways. For research use only.
1
Chemical Specifications
- Purity (HPLC)
- ≥99% (HPLC)
- Molecular Weight
- 5,135.9 Da
- Category
- Secretagogues
- Form
- Lyophilized Powder
- Storage
- -20°C, desiccated
- Amino Acid Sequence
- YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Stored at −20°C
Third-Party Tested
Certificates of Analysis
Not for Human Consumption | Research Use Only. All products are intended strictly for in-vitro laboratory research purposes only. Not for human or animal consumption.
This product is intended solely for laboratory research. Not for human consumption. No therapeutic claims are made or implied.
